SCOPe 2.03: Domain d1f9fd_: 1f9f D:

Lineage for d1f9fd_ (1f9f D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 18 [TaxId:333761] [54963] (2 PDB entries)

8. Domain d1f9fd_: 1f9f D: [39227]
   complexed with so4

Details for d1f9fd_

PDB Entry: 1f9f, 1.9 Å

PDB Description: crystal structure of the hpv-18 e2 dna-binding domain

PDB Compounds: (D:) Regulatory protein E2

SCOPe Domain Sequences for d1f9fd_:

Sequence; same for both SEQRES and ATOM records:

>d1f9fd_ d.58.8.1 (D:) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
shmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqr
tkflntvaipdsvqilvgymtm

Timeline for d1f9fd_:

• d1f9fd_ first appeared (with stable ids) in SCOP 1.55
  
• d1f9fd_ appears in SCOPe 2.02
  
• d1f9fd_ appears in SCOPe 2.04
  
• d1f9fd_ appears in the current release, SCOPe 2.08, called d1f9fd1