Lineage for d1f9fd_ (1f9f D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32738Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 32739Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 32746Protein Papillomavirus-1 E2 protein [54959] (4 species)
  7. 32753Species Human papillomavirus type 18 [TaxId:333761] [54963] (1 PDB entry)
  8. 32757Domain d1f9fd_: 1f9f D: [39227]

Details for d1f9fd_

PDB Entry: 1f9f (more details), 1.9 Å

PDB Description: crystal structure of the hpv-18 e2 dna-binding domain
PDB Compounds: (D:)

SCOP Domain Sequences for d1f9fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9fd_ d.58.8.1 (D:) Papillomavirus-1 E2 protein {Human papillomavirus type 18}
shmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqr
tkflntvaipdsvqilvgymtm

SCOP Domain Coordinates for d1f9fd_:

Click to download the PDB-style file with coordinates for d1f9fd_.
(The format of our PDB-style files is described here.)

Timeline for d1f9fd_: