![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
![]() | Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
![]() | Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
![]() | Species Human papillomavirus type 18 [TaxId:333761] [54963] (2 PDB entries) |
![]() | Domain d1f9fc1: 1f9f C:287-365 [39226] Other proteins in same PDB: d1f9fa2, d1f9fb2, d1f9fc2, d1f9fd2 complexed with so4 |
PDB Entry: 1f9f (more details), 1.9 Å
SCOPe Domain Sequences for d1f9fc1:
Sequence, based on SEQRES records: (download)
>d1f9fc1 d.58.8.1 (C:287-365) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]} tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqrtkf lntvaipdsvqilvgymtm
>d1f9fc1 d.58.8.1 (C:287-365) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]} tpiihlkgdrnslkclryrlrkhsdhyrdisstwhwttgiltvtyhsetqrtkflntvai pdsvqilvgymtm
Timeline for d1f9fc1: