Lineage for d6twvk1 (6twv K:1-318)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776288Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391916] (10 PDB entries)
  8. 2776312Domain d6twvk1: 6twv K:1-318 [392255]
    Other proteins in same PDB: d6twva2, d6twvb_, d6twvd_, d6twve2, d6twvf_, d6twvh_, d6twvi2, d6twvj_, d6twvk2, d6twvl_
    automated match to d3ztna_
    complexed with ca, gal, nag, sia; mutant

Details for d6twvk1

PDB Entry: 6twv (more details), 2.55 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu) from an h10n7 seal influenza virus isolated in germany with human receptor analogue, 6'sln
PDB Compounds: (K:) hemagglutinin HA1

SCOPe Domain Sequences for d6twvk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6twvk1 b.19.1.0 (K:1-318) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknnfvpvvgarpqvnglsgridfhwtlvqpgdkitfsh
nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d6twvk1:

Click to download the PDB-style file with coordinates for d6twvk1.
(The format of our PDB-style files is described here.)

Timeline for d6twvk1: