SCOPe 2.08: Domain d6u5ib_: 6u5i B:

Lineage for d6u5ib_ (6u5i B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [392251] (2 PDB entries)

8. Domain d6u5ib_: 6u5i B: [392252]
   automated match to d1g0nb_
   complexed with nad

Details for d6u5ib_

PDB Entry: 6u5i, 1.8 Å

PDB Description: crystal structure of ketoreductase (ashadh2) complex with nad+ from ascaris suum

PDB Compounds: (B:) 3-hydroxyacyl-CoA dehydrogenase type-2

SCOPe Domain Sequences for d6u5ib_:

Sequence; same for both SEQRES and ATOM records:

>d6u5ib_ c.2.1.0 (B:) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
salrstkglvalvtggasglgrgaaenllkhgakvaildlpssagaevakelggdciftp
asvtaasevksaladvkkkfgrldvavncagiaysfklfnvkkkklcdlesvrktldvnv
mgyftvaahaaelfaenekdemgqrgviintasiaafdgqagqsaysaskgaivgmtlpl
ardfaddgirvvtiapgifdtpmmasfpdkvrnfliglvpnpkrfgvpeeygalvrhiie
nrylngevirldgalrmpa

Timeline for d6u5ib_:

• d6u5ib_ first appeared in SCOPe 2.07