Lineage for d6tvtf_ (6tvt F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040861Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [419795] (10 PDB entries)
  8. 3040870Domain d6tvtf_: 6tvt F: [392247]
    Other proteins in same PDB: d6tvta1, d6tvta2, d6tvtc1, d6tvtc2, d6tvte1, d6tvte2
    automated match to d4d00d_
    complexed with ca, gal, nag, sia; mutant

Details for d6tvtf_

PDB Entry: 6tvt (more details), 2.2 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu, del228) from an h10n7 seal influenza virus isolated in germany in complex with human receptor analogue 6'-sln
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d6tvtf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvtf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d6tvtf_:

Click to download the PDB-style file with coordinates for d6tvtf_.
(The format of our PDB-style files is described here.)

Timeline for d6tvtf_: