Lineage for d1f9fa_ (1f9f A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724702Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 724703Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 724710Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 724724Species Human papillomavirus type 18 [TaxId:333761] [54963] (2 PDB entries)
  8. 724725Domain d1f9fa_: 1f9f A: [39224]

Details for d1f9fa_

PDB Entry: 1f9f (more details), 1.9 Å

PDB Description: crystal structure of the hpv-18 e2 dna-binding domain
PDB Compounds: (A:) Regulatory protein E2

SCOP Domain Sequences for d1f9fa_:

Sequence, based on SEQRES records: (download)

>d1f9fa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
hmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqrt
kflntvaipdsvqilvgymtm

Sequence, based on observed residues (ATOM records): (download)

>d1f9fa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 18 [TaxId: 333761]}
hmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwektgiltvtyhsetqrtkflnt
vaipdsvqilvgymtm

SCOP Domain Coordinates for d1f9fa_:

Click to download the PDB-style file with coordinates for d1f9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1f9fa_: