SCOPe 2.07: Domain d6txob_: 6txo B:

Lineage for d6txob_ (6txo B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (36 species)
   not a true protein

7. Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391914] (10 PDB entries)

8. Domain d6txob_: 6txo B: [392231]
   Other proteins in same PDB: d6txoa_, d6txoc_, d6txoe_
   automated match to d4d00d_
   complexed with ca, edo, gal, nag, sia; mutant

Details for d6txob_

PDB Entry: 6txo, 2.4 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu, del228) from an h10n7 seal influenza virus isolated in germany in complex with avian receptor analogue 3'-sln

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d6txob_:

Sequence; same for both SEQRES and ATOM records:

>d6txob_ h.3.1.1 (B:) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d6txob_:

• d6txob_ is new in SCOPe 2.07-stable
  
• d6txob_ appears in the current release, SCOPe 2.08