SCOPe 2.05: Domain d1by9a_: 1by9 A:

Lineage for d1by9a_ (1by9 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 16 [TaxId:333760] [54962] (5 PDB entries)
   Uniprot P03120 286-365

8. Domain d1by9a_: 1by9 A: [39223]

Details for d1by9a_

PDB Entry: 1by9, 2.2 Å

PDB Description: crystal structure of the e2 dna-binding domain from human papillomavirus type-16: implications for its dna binding-site selection mechanism

PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1by9a_:

Sequence, based on SEQRES records:

>d1by9a_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
ttpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfms

Sequence, based on observed residues (ATOM records):

>d1by9a_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
ttpivhlkgdantlkclryrfkkhctlytavsstwhwtaivtltydsewqrdqflsqvki
pktitvstgfms

Timeline for d1by9a_:

• d1by9a_ first appeared (with stable ids) in SCOP 1.55, called d1by9__
  
• d1by9a_ appears in SCOPe 2.04
  
• d1by9a_ appears in SCOPe 2.06
  
• d1by9a_ appears in the current release, SCOPe 2.08