SCOPe 2.07: Domain d6twsg1: 6tws G:1-318

Lineage for d6twsg1 (6tws G:1-318)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391916] (10 PDB entries)

8. Domain d6twsg1: 6tws G:1-318 [392207]
   Other proteins in same PDB: d6twsa2, d6twsb_, d6twsc2, d6twsd_, d6twsg2, d6twsh_
   automated match to d3ztna_
   complexed with edo, nag; mutant

Details for d6twsg1

PDB Entry: 6tws, 2 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu, gly228ser) from an h10n7 seal influenza virus isolated in germany with 2mm edta

PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d6twsg1:

Sequence; same for both SEQRES and ATOM records:

>d6twsg1 b.19.1.0 (G:1-318) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknnfvpvvgarpqvnglssridfhwtlvqpgdkitfsh
nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

Timeline for d6twsg1:

• d6twsg1 is new in SCOPe 2.07-stable
  
• d6twsg1 appears in the current release, SCOPe 2.08