Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) |
Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins) |
Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
Species Human papillomavirus type 31 [TaxId:10585] [54961] (2 PDB entries) |
Domain d1a7ge_: 1a7g E: [39220] complexed with so4 |
PDB Entry: 1a7g (more details), 2.4 Å
SCOP Domain Sequences for d1a7ge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7ge_ d.58.8.1 (E:) Papillomavirus-1 E2 protein {Human papillomavirus type 31 [TaxId: 10585]} attpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsqr ddflntvvipntvsvstgymti
Timeline for d1a7ge_: