Lineage for d1a7ge_ (1a7g E:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724702Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 724703Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 724710Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 724731Species Human papillomavirus type 31 [TaxId:10585] [54961] (2 PDB entries)
  8. 724732Domain d1a7ge_: 1a7g E: [39220]
    complexed with so4

Details for d1a7ge_

PDB Entry: 1a7g (more details), 2.4 Å

PDB Description: the crystal structure of the e2 dna-binding domain from human papillomavirus at 2.4 angstroms
PDB Compounds: (E:) Regulatory protein E2

SCOP Domain Sequences for d1a7ge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7ge_ d.58.8.1 (E:) Papillomavirus-1 E2 protein {Human papillomavirus type 31 [TaxId: 10585]}
attpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsqr
ddflntvvipntvsvstgymti

SCOP Domain Coordinates for d1a7ge_:

Click to download the PDB-style file with coordinates for d1a7ge_.
(The format of our PDB-style files is described here.)

Timeline for d1a7ge_: