Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries) |
Domain d6tvcb_: 6tvc B: [392191] Other proteins in same PDB: d6tvca1, d6tvca2, d6tvcc1, d6tvcc2, d6tvce1, d6tvce2 automated match to d4cyvb_ complexed with nag |
PDB Entry: 6tvc (more details), 1.84 Å
SCOPe Domain Sequences for d6tvcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tvcb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntynhsqyreeallnrln
Timeline for d6tvcb_: