Lineage for d1dbdb_ (1dbd B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909140Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 1909141Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 1909148Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 1909149Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (3 PDB entries)
  8. 1909155Domain d1dbdb_: 1dbd B: [39219]

Details for d1dbdb_

PDB Entry: 1dbd (more details)

PDB Description: e2 dna-binding domain from papillomavirus bpv-1
PDB Compounds: (B:) Regulatory protein E2

SCOPe Domain Sequences for d1dbdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbdb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
rrttndgfhllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaer
qgqaqilitfgspsqrqdflkhvplppgmnisgftasldf

SCOPe Domain Coordinates for d1dbdb_:

Click to download the PDB-style file with coordinates for d1dbdb_.
(The format of our PDB-style files is described here.)

Timeline for d1dbdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dbda_