SCOPe 2.08: Domain d1dbdb_: 1dbd B:

Lineage for d1dbdb_ (1dbd B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (4 PDB entries)

8. Domain d1dbdb_: 1dbd B: [39219]

Details for d1dbdb_

PDB Entry: 1dbd

PDB Description: e2 dna-binding domain from papillomavirus bpv-1

PDB Compounds: (B:) Regulatory protein E2

SCOPe Domain Sequences for d1dbdb_:

Sequence; same for both SEQRES and ATOM records:

>d1dbdb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
rrttndgfhllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaer
qgqaqilitfgspsqrqdflkhvplppgmnisgftasldf

Timeline for d1dbdb_:

• d1dbdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dbdb_ appears in SCOPe 2.07