Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein Photosystem I iron-sulfur protein PsaC [64272] (3 species) |
Species Thermosynechococcus elongatus [TaxId:197221] [377867] (4 PDB entries) |
Domain d6trc3_: 6trc 3: [392180] Other proteins in same PDB: d6trc0_, d6trc1_, d6trc2_, d6trc4_, d6trc5_, d6trc6_, d6trc7_, d6trc8_, d6trca_, d6trcb_, d6trcd_, d6trce_, d6trcf_, d6trci_, d6trcj_, d6trcl_, d6trcm_, d6trcy_ automated match to d1jb0c_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6trc (more details), 2.98 Å
SCOPe Domain Sequences for d6trc3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trc3_ d.58.1.2 (3:) Photosystem I iron-sulfur protein PsaC {Thermosynechococcus elongatus [TaxId: 197221]} ahtvkiydtcigctqcvracptdvlemvpwdgckagqiassprtedcvgckrcetacptd flsirvylgaettrsmglay
Timeline for d6trc3_: