![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Cleavage stimulation factor, 64 kda subunit [102983] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102984] (3 PDB entries) |
![]() | Domain d6tzea_: 6tze A: [392171] automated match to d1p1ta_ mutant |
PDB Entry: 6tze (more details)
SCOPe Domain Sequences for d6tzea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tzea_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} magltvrdpavdrslrsvfvgnipyeateeqlkdifsevgpvvsfrlvyaretgkpkgyg fceyqdqetalsamrnlngrefsgralrvdnaaseknkeelkslgtg
Timeline for d6tzea_: