SCOPe 2.01: Domain d1ft8c2: 1ft8 C:117-198

Lineage for d1ft8c2 (1ft8 C:117-198)

Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)
Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
Protein mRNA export factor tap [54955] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
Domain d1ft8c2: 1ft8 C:117-198 [39215]
Other proteins in same PDB: d1ft8a1, d1ft8b_, d1ft8c1, d1ft8d_
chain E domain disordered

Details for d1ft8c2

PDB Entry: 1ft8 (more details), 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

PDB Compounds: (C:) tip associating protein

SCOPe Domain Sequences for d1ft8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft8c2 d.58.7.2 (C:117-198) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
knwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavn
ykildrenrrisiiinssapph

SCOPe Domain Coordinates for d1ft8c2:

Click to download the PDB-style file with coordinates for d1ft8c2.
(The format of our PDB-style files is described here.)

Timeline for d1ft8c2: