SCOPe 2.07: Domain d6tvsk1: 6tvs K:3-320

Lineage for d6tvsk1 (6tvs K:3-320)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391916] (10 PDB entries)

8. Domain d6tvsk1: 6tvs K:3-320 [392146]
   Other proteins in same PDB: d6tvsc2, d6tvsd_, d6tvse2, d6tvsf_, d6tvsk2, d6tvsl_
   automated match to d3ztna_
   complexed with ca, edo, nag; mutant

Details for d6tvsk1

PDB Entry: 6tvs, 1.9 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu) from an h10n7 seal influenza virus isolated in germany in complex with avian receptor analogue 3'-sln

PDB Compounds: (K:) hemagglutinin HA1

SCOPe Domain Sequences for d6tvsk1:

Sequence; same for both SEQRES and ATOM records:

>d6tvsk1 b.19.1.0 (K:3-320) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknnfvpvvgarpqvnglsgridfhwtlvqpgdkitfsh
nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

Timeline for d6tvsk1:

• d6tvsk1 is new in SCOPe 2.07-stable
  
• d6tvsk1 appears in the current release, SCOPe 2.08