Lineage for d6trc1_ (6trc 1:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633138Protein Apoprotein a1, PsaA [81554] (2 species)
  7. 2633141Species Thermosynechococcus elongatus [TaxId:197221] [392076] (2 PDB entries)
  8. 2633143Domain d6trc1_: 6trc 1: [392135]
    Other proteins in same PDB: d6trc0_, d6trc2_, d6trc3_, d6trc4_, d6trc5_, d6trc6_, d6trc7_, d6trc8_, d6trcb_, d6trcc_, d6trcd_, d6trce_, d6trcf_, d6trci_, d6trcj_, d6trcl_, d6trcm_, d6trcy_
    automated match to d1jb0a_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trc1_

PDB Entry: 6trc (more details), 2.98 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (1:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d6trc1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trc1_ f.29.1.1 (1:) Apoprotein a1, PsaA {Thermosynechococcus elongatus [TaxId: 197221]}
pkvrvvvdndpvptsfekwakpghfdrtlargpqtttwiwnlhalahdfdthtsdledis
rkifsahfghlavvfiwlsgmyfhgakfsnyeawladptgikpsaqvvwpivgqgilngd
vgggfhgiqitsglfqlwrasgitnefqlyctaigglvmaglmlfagwfhyhkrapklew
fqnvesmlnhhlagllglgslawaghqihvslpinklldagvaakdiplphefilnpslm
aelypkvdwgffsgvipfftfnwaaysdfltfngglnpvtgglwlsdtahhhlaiavlfi
iaghmyrtnwgighslkeileahkgpftgaghkglyevlttswhaqlainlammgslsii
vaqhmyamppypylatdyptqlslfthhmwiggflvvggaahgaifmvrdydpamnqnnv
ldrvlrhrdaiishlnwvciflgfhsfglyvhndtmrafgrpqdmfsdtgiqlqpvfaqw
vqnlhtlapggtapnaaatasvafggdvvavggkvammpivlgtadfmvhhihaftihvt
vlillkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyncisvv
ifhfswkmqsdvwgtvapdgtvshitggnfaqsaitingwlrdflwaqasqvigsygsal
saygllflgahfiwafslmflfsgrgywqeliesivwahnklkvapaiqpralsiiqgra
vgvahyllggiattwafflariisvg

SCOPe Domain Coordinates for d6trc1_:

Click to download the PDB-style file with coordinates for d6trc1_.
(The format of our PDB-style files is described here.)

Timeline for d6trc1_: