Lineage for d1fo1a2 (1fo1 A:123-191)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1028410Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 1028411Protein mRNA export factor tap [54955] (1 species)
  7. 1028412Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
  8. 1028417Domain d1fo1a2: 1fo1 A:123-191 [39213]
    Other proteins in same PDB: d1fo1a1, d1fo1b_
    disordered

Details for d1fo1a2

PDB Entry: 1fo1 (more details), 2.9 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap
PDB Compounds: (A:) nuclear RNA export factor 1

SCOPe Domain Sequences for d1fo1a2:

Sequence, based on SEQRES records: (download)

>d1fo1a2 d.58.7.2 (A:123-191) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
tipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavnykildr
enrrisiii

Sequence, based on observed residues (ATOM records): (download)

>d1fo1a2 d.58.7.2 (A:123-191) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
tipygrkydkawllsmiqskcftpiefhyentraalkavnykildrenrrisiii

SCOPe Domain Coordinates for d1fo1a2:

Click to download the PDB-style file with coordinates for d1fo1a2.
(The format of our PDB-style files is described here.)

Timeline for d1fo1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fo1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fo1b_