Lineage for d1fo1a2 (1fo1 A:123-191)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80286Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 80385Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 80386Protein mRNA export factor tap [54955] (1 species)
  7. 80387Species Human (Homo sapiens) [TaxId:9606] [54956] (2 PDB entries)
  8. 80388Domain d1fo1a2: 1fo1 A:123-191 [39213]
    Other proteins in same PDB: d1fo1a1, d1fo1b1

Details for d1fo1a2

PDB Entry: 1fo1 (more details), 2.9 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

SCOP Domain Sequences for d1fo1a2:

Sequence, based on SEQRES records: (download)

>d1fo1a2 d.58.7.2 (A:123-191) mRNA export factor tap {Human (Homo sapiens)}
tipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavnykildr
enrrisiii

Sequence, based on observed residues (ATOM records): (download)

>d1fo1a2 d.58.7.2 (A:123-191) mRNA export factor tap {Human (Homo sapiens)}
tipygrkydkawllsmiqskcftpiefhyentraalkavnykildrenrrisiii

SCOP Domain Coordinates for d1fo1a2:

Click to download the PDB-style file with coordinates for d1fo1a2.
(The format of our PDB-style files is described here.)

Timeline for d1fo1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fo1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fo1b1