SCOPe 2.08: Domain d6twhb_: 6twh B:

Lineage for d6twhb_ (6twh B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [419795] (10 PDB entries)

8. Domain d6twhb_: 6twh B: [392129]
   Other proteins in same PDB: d6twha1, d6twha2, d6twhc1, d6twhc2, d6twhe1, d6twhe2, d6twhl1, d6twhl2, d6twhn1, d6twhn2, d6twhp1, d6twhp2
   automated match to d4d00d_
   complexed with ca, nag; mutant

Details for d6twhb_

PDB Entry: 6twh, 2.68 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu, gly228ser) from an h10n7 seal influenza virus isolated in germany

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d6twhb_:

Sequence; same for both SEQRES and ATOM records:

>d6twhb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d6twhb_:

• d6twhb_ first appeared in SCOPe 2.07