Lineage for d6tvda1 (6tvd A:1-318)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386336Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2386370Domain d6tvda1: 6tvd A:1-318 [392117]
    Other proteins in same PDB: d6tvda2, d6tvdb_, d6tvdd_, d6tvdf_, d6tvdg2, d6tvdh_, d6tvdj_, d6tvdl_
    automated match to d3ztna_
    complexed with ca, nag

Details for d6tvda1

PDB Entry: 6tvd (more details), 2.7 Å

PDB Description: crystal structure of the haemagglutinin from a h10n7 seal influenza virus isolated in germany in complex with avian receptor analogue, 3'-sln
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d6tvda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvda1 b.19.1.0 (A:1-318) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknnfvpvvgarpqvngqsgridfhwtlvqpgdkitfsh
nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d6tvda1:

Click to download the PDB-style file with coordinates for d6tvda1.
(The format of our PDB-style files is described here.)

Timeline for d6tvda1: