Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
Domain d6tvda1: 6tvd A:1-318 [392117] Other proteins in same PDB: d6tvda2, d6tvdb_, d6tvdd_, d6tvdf_, d6tvdg2, d6tvdh_, d6tvdj_, d6tvdl_ automated match to d3ztna_ complexed with ca, nag |
PDB Entry: 6tvd (more details), 2.7 Å
SCOPe Domain Sequences for d6tvda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tvda1 b.19.1.0 (A:1-318) automated matches {Influenza A virus, different strains [TaxId: 11320]} dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss tqekndlygtqslsisvgsstyknnfvpvvgarpqvngqsgridfhwtlvqpgdkitfsh nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk yvnkkslmlatgmrnvpe
Timeline for d6tvda1: