Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries) |
Domain d6tvfh_: 6tvf H: [392109] Other proteins in same PDB: d6tvfa1, d6tvfa2, d6tvfc1, d6tvfc2, d6tvfe1, d6tvfe2, d6tvfg1, d6tvfg2, d6tvfi1, d6tvfi2, d6tvfk_ automated match to d4d00d_ complexed with ca, gal, nag, sia |
PDB Entry: 6tvf (more details), 2.6 Å
SCOPe Domain Sequences for d6tvfh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tvfh_ h.3.1.1 (H:) automated matches {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
Timeline for d6tvfh_: