Lineage for d6tvfh_ (6tvf H:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646215Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)
  8. 2646245Domain d6tvfh_: 6tvf H: [392109]
    Other proteins in same PDB: d6tvfa1, d6tvfa2, d6tvfc1, d6tvfc2, d6tvfe1, d6tvfe2, d6tvfg1, d6tvfg2, d6tvfi1, d6tvfi2, d6tvfk_
    automated match to d4d00d_
    complexed with ca, gal, nag, sia

Details for d6tvfh_

PDB Entry: 6tvf (more details), 2.6 Å

PDB Description: crystal structure of the haemagglutinin from a h10n7 seal influenza virus isolated in germany in complex with human receptor analogue, 6'-sln
PDB Compounds: (H:) hemagglutinin HA2

SCOPe Domain Sequences for d6tvfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvfh_ h.3.1.1 (H:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d6tvfh_:

Click to download the PDB-style file with coordinates for d6tvfh_.
(The format of our PDB-style files is described here.)

Timeline for d6tvfh_: