Lineage for d6trdl_ (6trd l:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633219Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 2633220Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 2633221Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins)
  6. 2633225Protein automated matches [347525] (2 species)
    not a true protein
  7. 2633231Species Thermosynechococcus elongatus [TaxId:197221] [377769] (4 PDB entries)
  8. 2633236Domain d6trdl_: 6trd l: [392106]
    Other proteins in same PDB: d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdm_, d6trdy_
    automated match to d1jb0l_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trdl_

PDB Entry: 6trd (more details), 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (l:) Photosystem I reaction center subunit XI

SCOPe Domain Sequences for d6trdl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trdl_ f.31.1.1 (l:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpw
vklgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqfta
gffvgamgsafvaffllenflvvdgimtglfn

SCOPe Domain Coordinates for d6trdl_:

Click to download the PDB-style file with coordinates for d6trdl_.
(The format of our PDB-style files is described here.)

Timeline for d6trdl_: