SCOP 1.65: Domain d1fjeb1: 1fje B:1-91

Lineage for d1fjeb1 (1fje B:1-91)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families)

5. Family d.58.7.1: Canonical RBD [54929] (16 proteins)

6. Protein Nucleolin [54952] (1 species)

7. Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54953] (3 PDB entries)

8. Domain d1fjeb1: 1fje B:1-91 [39210]

Details for d1fjeb1

PDB Entry: 1fje

PDB Description: solution structure of nucleolin rbd12 in complex with snre rna

SCOP Domain Sequences for d1fjeb1:

Sequence; same for both SEQRES and ATOM records:

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus)}
gshmvegsesttpfnlfignlnpnksvaelkvaiselfakndlavvdvrtgtnrkfgyvd
fesaedlekaleltglkvfgneiklekpkgr

Timeline for d1fjeb1:

• d1fjeb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fjeb1 appears in SCOP 1.63
  
• d1fjeb1 appears in SCOP 1.67
  
• d1fjeb1 appears in the current release, SCOPe 2.08