Lineage for d6trc2_ (6trc 2:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633191Species Thermosynechococcus elongatus [TaxId:197221] [377774] (4 PDB entries)
  8. 2633193Domain d6trc2_: 6trc 2: [392099]
    Other proteins in same PDB: d6trc0_, d6trc1_, d6trc3_, d6trc4_, d6trc5_, d6trc6_, d6trc7_, d6trc8_, d6trca_, d6trcc_, d6trcd_, d6trce_, d6trcf_, d6trci_, d6trcj_, d6trcl_, d6trcm_, d6trcy_
    automated match to d5l8rb_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trc2_

PDB Entry: 6trc (more details), 2.98 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (2:) photosystem I p700 chlorophyll a apoprotein a2

SCOPe Domain Sequences for d6trc2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trc2_ f.29.1.1 (2:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
atkfpkfsqdlaqdpttrriwyaiamahdfeshdgmteenlyqkifashfghlaiiflwv
sgslfhvawqgnfeqwvqdpvntrpiahaiwdpqfgkaavdaftqagasnpvdiaysgvy
hwwytigmrtngdlyqgaifllilaslalfagwlhlqpkfrpslswfknaesrlnhhlag
lfgvsslawaghlihvaipesrgqhvgwdnflstmphpaglapfftgnwgvyaqnpdtas
hvfgtaqgagtailtflggfhpqteslwltdmahhhlaiavlfivaghmyrtqfgighsi
kemmdakdffgtkvegpfnmphqgiyetynnslhfqlgwhlaclgvitslvaqhmyslpp
yafiaqdhttmaalythhqyiagflmvgafahgaiflvrdydpaqnkgnvldrvlqhkea
iishlswvslflgfhtlglyvhndvvvafgtpekqiliepvfaqfiqaahgkllygfdtl
lsnpdsiastawpnygnvwlpgwldainsgtnslfltigpgdflvhhaialglhtttlil
vkgaldargsklmpdkkdfgyafpcdgpgrggtcdisawdafylamfwmlntigwvtfyw
hwkhlgvwegnvaqfnesstylmgwlrdylwlnssqlingynpfgtnnlsvwawmflfgh
lvwatgfmfliswrgywqelietlvwahertplanlvrwkdkpvalsivqarlvglahfs
vgyiltyaafliastaakfg

SCOPe Domain Coordinates for d6trc2_:

Click to download the PDB-style file with coordinates for d6trc2_.
(The format of our PDB-style files is described here.)

Timeline for d6trc2_: