SCOPe 2.07: Domain d6trc8_: 6trc 8:

Lineage for d6trc8_ (6trc 8:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families)
   automatically mapped to Pfam PF01701

5. Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins)

6. Protein Subunit IX of photosystem I reaction centre, PsaJ [81542] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377947] (4 PDB entries)

8. Domain d6trc8_: 6trc 8: [392098]
   Other proteins in same PDB: d6trc0_, d6trc1_, d6trc2_, d6trc3_, d6trc4_, d6trc5_, d6trc6_, d6trc7_, d6trca_, d6trcb_, d6trcc_, d6trcd_, d6trce_, d6trcf_, d6trci_, d6trcl_, d6trcm_, d6trcy_
   automated match to d1jb0j_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trc8_

PDB Entry: 6trc, 2.98 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6

PDB Compounds: (8:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6trc8_:

Sequence; same for both SEQRES and ATOM records:

>d6trc8_ f.23.18.1 (8:) Subunit IX of photosystem I reaction centre, PsaJ {Thermosynechococcus elongatus [TaxId: 197221]}
mkhfltylstapvlaaiwmtitagiliefnrfypdllfhpl

Timeline for d6trc8_:

• d6trc8_ is new in SCOPe 2.07-stable
  
• d6trc8_ appears in the current release, SCOPe 2.08