SCOPe 2.07: Domain d6trd8_: 6trd 8:

Lineage for d6trd8_ (6trd 8:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families)
   automatically mapped to Pfam PF01701

5. Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins)

6. Protein Subunit IX of photosystem I reaction centre, PsaJ [81542] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377947] (4 PDB entries)

8. Domain d6trd8_: 6trd 8: [392089]
   Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdl_, d6trdm_, d6trdy_
   automated match to d1jb0j_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trd8_

PDB Entry: 6trd, 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6

PDB Compounds: (8:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6trd8_:

Sequence; same for both SEQRES and ATOM records:

>d6trd8_ f.23.18.1 (8:) Subunit IX of photosystem I reaction centre, PsaJ {Thermosynechococcus elongatus [TaxId: 197221]}
mkhfltylstapvlaaiwmtitagiliefnrfypdllfhpl

Timeline for d6trd8_:

• d6trd8_ is new in SCOPe 2.07-stable
  
• d6trd8_ appears in the current release, SCOPe 2.08