SCOPe 2.07: Domain d6trcy_: 6trc y:

Lineage for d6trcy_ (6trc y:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.19: Subunit XII of photosystem I reaction centre, PsaM [81548] (1 family)
   automatically mapped to Pfam PF07465

5. Family f.23.19.1: Subunit XII of photosystem I reaction centre, PsaM [81547] (2 proteins)

6. Protein Subunit XII of photosystem I reaction centre, PsaM [81546] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377772] (4 PDB entries)

8. Domain d6trcy_: 6trc y: [392087]
   Other proteins in same PDB: d6trc0_, d6trc1_, d6trc2_, d6trc3_, d6trc4_, d6trc5_, d6trc6_, d6trc7_, d6trc8_, d6trca_, d6trcb_, d6trcc_, d6trcd_, d6trce_, d6trcf_, d6trci_, d6trcj_, d6trcl_
   automated match to d1jb0m_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trcy_

PDB Entry: 6trc, 2.98 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6

PDB Compounds: (y:) Photosystem I reaction center subunit XII

SCOPe Domain Sequences for d6trcy_:

Sequence; same for both SEQRES and ATOM records:

>d6trcy_ f.23.19.1 (y:) Subunit XII of photosystem I reaction centre, PsaM {Thermosynechococcus elongatus [TaxId: 197221]}
maltdtqvyvalviallpavlafrlstelyk

Timeline for d6trcy_:

• d6trcy_ is new in SCOPe 2.07-stable
  
• d6trcy_ appears in the current release, SCOPe 2.08