Lineage for d6trc6_ (6trc 6:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631476Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 2631477Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)
  6. 2631481Protein automated matches [236583] (4 species)
    not a true protein
  7. 2631491Species Thermosynechococcus elongatus [TaxId:197221] [377791] (4 PDB entries)
  8. 2631493Domain d6trc6_: 6trc 6: [392086]
    Other proteins in same PDB: d6trc0_, d6trc1_, d6trc2_, d6trc3_, d6trc4_, d6trc5_, d6trc7_, d6trc8_, d6trca_, d6trcb_, d6trcc_, d6trcd_, d6trce_, d6trci_, d6trcj_, d6trcl_, d6trcm_, d6trcy_
    automated match to d1jb0f_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trc6_

PDB Entry: 6trc (more details), 2.98 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (6:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d6trc6_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trc6_ f.23.16.1 (6:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
dvaglvpckdspafqkraaaavnttadpasgqkrferysqalcgedglphlvvdgrlsra
gdflipsvlflyiagwigwvgrayliavrnsgeanekeiiidvplaikcmltgfawplaa
lkelasgeltakdneitvspr

SCOPe Domain Coordinates for d6trc6_:

Click to download the PDB-style file with coordinates for d6trc6_.
(The format of our PDB-style files is described here.)

Timeline for d6trc6_: