Lineage for d6tram_ (6tra M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631581Superfamily f.23.19: Subunit XII of photosystem I reaction centre, PsaM [81548] (1 family) (S)
    automatically mapped to Pfam PF07465
  5. 2631582Family f.23.19.1: Subunit XII of photosystem I reaction centre, PsaM [81547] (2 proteins)
  6. 2631583Protein Subunit XII of photosystem I reaction centre, PsaM [81546] (2 species)
  7. 2631586Species Thermosynechococcus elongatus [TaxId:197221] [377772] (4 PDB entries)
  8. 2631587Domain d6tram_: 6tra M: [392084]
    Other proteins in same PDB: d6traa_, d6trab_, d6trac_, d6trad_, d6trae_, d6traf_, d6trai_, d6traj_, d6tral_
    automated match to d1jb0m_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6tram_

PDB Entry: 6tra (more details), 2.85 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (M:) Photosystem I reaction center subunit XII

SCOPe Domain Sequences for d6tram_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tram_ f.23.19.1 (M:) Subunit XII of photosystem I reaction centre, PsaM {Thermosynechococcus elongatus [TaxId: 197221]}
maltdtqvyvalviallpavlafrlstelyk

SCOPe Domain Coordinates for d6tram_:

Click to download the PDB-style file with coordinates for d6tram_.
(The format of our PDB-style files is described here.)

Timeline for d6tram_: