Lineage for d6trc0_ (6trc 0:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633219Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 2633220Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 2633221Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins)
  6. 2633225Protein automated matches [347525] (2 species)
    not a true protein
  7. 2633231Species Thermosynechococcus elongatus [TaxId:197221] [377769] (4 PDB entries)
  8. 2633233Domain d6trc0_: 6trc 0: [392080]
    Other proteins in same PDB: d6trc1_, d6trc2_, d6trc3_, d6trc4_, d6trc5_, d6trc6_, d6trc7_, d6trc8_, d6trca_, d6trcb_, d6trcc_, d6trcd_, d6trce_, d6trcf_, d6trci_, d6trcj_, d6trcm_, d6trcy_
    automated match to d1jb0l_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trc0_

PDB Entry: 6trc (more details), 2.98 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (0:) Photosystem I reaction center subunit XI

SCOPe Domain Sequences for d6trc0_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trc0_ f.31.1.1 (0:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpw
vklgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqfta
gffvgamgsafvaffllenflvvdgimtglfn

SCOPe Domain Coordinates for d6trc0_:

Click to download the PDB-style file with coordinates for d6trc0_.
(The format of our PDB-style files is described here.)

Timeline for d6trc0_: