Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) automatically mapped to Pfam PF02605 |
Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins) |
Protein automated matches [347525] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [377769] (4 PDB entries) |
Domain d6trc0_: 6trc 0: [392080] Other proteins in same PDB: d6trc1_, d6trc2_, d6trc3_, d6trc4_, d6trc5_, d6trc6_, d6trc7_, d6trc8_, d6trca_, d6trcb_, d6trcc_, d6trcd_, d6trce_, d6trcf_, d6trci_, d6trcj_, d6trcm_, d6trcy_ automated match to d1jb0l_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6trc (more details), 2.98 Å
SCOPe Domain Sequences for d6trc0_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trc0_ f.31.1.1 (0:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} elvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpw vklgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqfta gffvgamgsafvaffllenflvvdgimtglfn
Timeline for d6trc0_: