Lineage for d1qm9a2 (1qm9 A:111-198)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) 
Family d.58.7.1: Canonical RBD [54929] (12 proteins) 
Protein Polypyrimidine tract-binding protein [54950] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54951] (1 PDB entry) 
Domain d1qm9a2: 1qm9 A:111-198 [39208]
Details for d1qm9a2
PDB Entry: 1qm9 (more details)
PDB Description: nmr, representative structure
SCOP Domain Sequences for d1qm9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qm9a2 d.58.7.1 (A:111-198) Polypyrimidine tract-binding protein {Human (Homo sapiens)}
knfqnifppsatlhlsnippsvseedlkvlfssnggvvkgfkffqkdrkmaliqmgsvee
avqalidlhnhdlgenhhlrvsfsksti
SCOP Domain Coordinates for d1qm9a2:
Click to download the PDB-style file with coordinates for d1qm9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qm9a2:
- d1qm9a2 appears in SCOP 1.57
- d1qm9a2 appears in the current release, SCOPe 2.08
View in 3D
