SCOPe 2.07: Domain d6tvba1: 6tvb A:1-318

Lineage for d6tvba1 (6tvb A:1-318)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)

8. Domain d6tvba1: 6tvb A:1-318 [392070]
   Other proteins in same PDB: d6tvba2, d6tvbb_, d6tvbc2, d6tvbd_, d6tvbe2, d6tvbf_
   automated match to d3ztna_
   complexed with edo, nag

Details for d6tvba1

PDB Entry: 6tvb, 1.65 Å

PDB Description: crystal structure of the haemagglutinin from a transmissible h10n7 seal influenza virus isolated in netherland in complex with human receptor analogue 6'-sln

PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d6tvba1:

Sequence; same for both SEQRES and ATOM records:

>d6tvba1 b.19.1.0 (A:1-318) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvnekalrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknsfvpvvgarpqvnglsgridfhwtlvqpgdkiifsh
nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

Timeline for d6tvba1:

• d6tvba1 is new in SCOPe 2.07-stable
  
• d6tvba1 appears in the current release, SCOPe 2.08