Lineage for d1qm9a1 (1qm9 A:1-110)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504527Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 504528Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 504624Protein Polypyrimidine tract-binding protein [54950] (1 species)
  7. 504625Species Human (Homo sapiens) [TaxId:9606] [54951] (3 PDB entries)
  8. 504628Domain d1qm9a1: 1qm9 A:1-110 [39207]

Details for d1qm9a1

PDB Entry: 1qm9 (more details)

PDB Description: nmr, representative structure

SCOP Domain Sequences for d1qm9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm9a1 d.58.7.1 (A:1-110) Polypyrimidine tract-binding protein {Human (Homo sapiens)}
mgnsvllvsnlnpervtpqslfilfgvygdvqrvkilfnkkenalvqmadgnqaqlamsh
lnghklhgkpiritlskhqnvqlpregqedqgltkdygnsplhrfkkpgs

SCOP Domain Coordinates for d1qm9a1:

Click to download the PDB-style file with coordinates for d1qm9a1.
(The format of our PDB-style files is described here.)

Timeline for d1qm9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qm9a2