Lineage for d1qm9a1 (1qm9 A:1-110)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. 32691Protein Polypyrimidine tract-binding protein [54950] (1 species)
  7. 32692Species Human (Homo sapiens) [TaxId:9606] [54951] (1 PDB entry)
  8. 32693Domain d1qm9a1: 1qm9 A:1-110 [39207]

Details for d1qm9a1

PDB Entry: 1qm9 (more details)

PDB Description: nmr, representative structure

SCOP Domain Sequences for d1qm9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm9a1 d.58.7.1 (A:1-110) Polypyrimidine tract-binding protein {Human (Homo sapiens)}
mgnsvllvsnlnpervtpqslfilfgvygdvqrvkilfnkkenalvqmadgnqaqlamsh
lnghklhgkpiritlskhqnvqlpregqedqgltkdygnsplhrfkkpgs

SCOP Domain Coordinates for d1qm9a1:

Click to download the PDB-style file with coordinates for d1qm9a1.
(The format of our PDB-style files is described here.)

Timeline for d1qm9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qm9a2