SCOPe 2.06: Domain d1cvjh2: 1cvj H:91-175

Lineage for d1cvjh2 (1cvj H:91-175)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Poly(A)-binding protein [54948] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)

8. Domain d1cvjh2: 1cvj H:91-175 [39206]
   protein/RNA complex; complexed with a

Details for d1cvjh2

PDB Entry: 1cvj, 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

PDB Compounds: (H:) polyadenylate binding protein 1

SCOPe Domain Sequences for d1cvjh2:

Sequence, based on SEQRES records:

>d1cvjh2 d.58.7.1 (H:91-175) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqea
aeraiekmngmllndrkvfvgrfks

Sequence, based on observed residues (ATOM records):

>d1cvjh2 d.58.7.1 (H:91-175) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}
pslrksgvgnifikalydtfsafgnilsckvvcskgygfvhfetqeaaefks

Timeline for d1cvjh2:

• d1cvjh2 first appeared (with stable ids) in SCOP 1.55
  
• d1cvjh2 appears in SCOPe 2.05
  
• d1cvjh2 appears in SCOPe 2.07
  
• d1cvjh2 appears in the current release, SCOPe 2.08