Lineage for d1cvjh2 (1cvj H:91-175)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257431Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 257432Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 257481Protein Poly(A)-binding protein [54948] (1 species)
  7. 257482Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)
  8. 257498Domain d1cvjh2: 1cvj H:91-175 [39206]
    protein/RNA complex

Details for d1cvjh2

PDB Entry: 1cvj (more details), 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

SCOP Domain Sequences for d1cvjh2:

Sequence, based on SEQRES records: (download)

>d1cvjh2 d.58.7.1 (H:91-175) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqea
aeraiekmngmllndrkvfvgrfks

Sequence, based on observed residues (ATOM records): (download)

>d1cvjh2 d.58.7.1 (H:91-175) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifikalydtfsafgnilsckvvcskgygfvhfetqeaaefks

SCOP Domain Coordinates for d1cvjh2:

Click to download the PDB-style file with coordinates for d1cvjh2.
(The format of our PDB-style files is described here.)

Timeline for d1cvjh2: