SCOP 1.61: Domain d1cvjh2: 1cvj H:91-175

Lineage for d1cvjh2 (1cvj H:91-175)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.58: Ferredoxin-like [54861] (40 superfamilies)

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families)

5. Family d.58.7.1: Canonical RBD [54929] (14 proteins)

6. Protein Poly(A)-binding protein [54948] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)

8. Domain d1cvjh2: 1cvj H:91-175 [39206]

Details for d1cvjh2

PDB Entry: 1cvj, 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

SCOP Domain Sequences for d1cvjh2:

Sequence, based on SEQRES records:

>d1cvjh2 d.58.7.1 (H:91-175) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqea
aeraiekmngmllndrkvfvgrfks

Sequence, based on observed residues (ATOM records):

>d1cvjh2 d.58.7.1 (H:91-175) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifikalydtfsafgnilsckvvcskgygfvhfetqeaaefks

Timeline for d1cvjh2:

• d1cvjh2 first appeared (with stable ids) in SCOP 1.55
  
• d1cvjh2 appears in SCOP 1.59
  
• d1cvjh2 appears in SCOP 1.63
  
• d1cvjh2 appears in the current release, SCOPe 2.08