SCOPe 2.07: Domain d6trci_: 6trc i:

Lineage for d6trci_ (6trc i:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family)

5. Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins)

6. Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377780] (4 PDB entries)

8. Domain d6trci_: 6trc i: [392053]
   Other proteins in same PDB: d6trc0_, d6trc1_, d6trc2_, d6trc3_, d6trc4_, d6trc5_, d6trc6_, d6trc8_, d6trca_, d6trcb_, d6trcc_, d6trcd_, d6trce_, d6trcf_, d6trcj_, d6trcl_, d6trcm_, d6trcy_
   automated match to d1jb0i_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trci_

PDB Entry: 6trc, 2.98 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6

PDB Compounds: (i:) Photosystem I reaction center subunit VIII

SCOPe Domain Sequences for d6trci_:

Sequence; same for both SEQRES and ATOM records:

>d6trci_ f.23.17.1 (i:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

Timeline for d6trci_:

• d6trci_ is new in SCOPe 2.07-stable
  
• d6trci_ appears in the current release, SCOPe 2.08