![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) ![]() automatically mapped to Pfam PF02507 |
![]() | Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins) |
![]() | Protein automated matches [236583] (4 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [377791] (4 PDB entries) |
![]() | Domain d6trdf_: 6trd f: [392041] Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd7_, d6trd8_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdi_, d6trdj_, d6trdl_, d6trdm_, d6trdy_ automated match to d1jb0f_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6trd (more details), 3.16 Å
SCOPe Domain Sequences for d6trdf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trdf_ f.23.16.1 (f:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} dvaglvpckdspafqkraaaavnttadpasgqkrferysqalcgedglphlvvdgrlsra gdflipsvlflyiagwigwvgrayliavrnsgeanekeiiidvplaikcmltgfawplaa lkelasgeltakdneitvspr
Timeline for d6trdf_: