SCOPe 2.07: Domain d6trdf_: 6trd f:

Lineage for d6trdf_ (6trd f:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families)
   automatically mapped to Pfam PF02507

5. Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)

6. Protein automated matches [236583] (4 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [377791] (4 PDB entries)

8. Domain d6trdf_: 6trd f: [392041]
   Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd7_, d6trd8_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdi_, d6trdj_, d6trdl_, d6trdm_, d6trdy_
   automated match to d1jb0f_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trdf_

PDB Entry: 6trd, 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6

PDB Compounds: (f:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d6trdf_:

Sequence; same for both SEQRES and ATOM records:

>d6trdf_ f.23.16.1 (f:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
dvaglvpckdspafqkraaaavnttadpasgqkrferysqalcgedglphlvvdgrlsra
gdflipsvlflyiagwigwvgrayliavrnsgeanekeiiidvplaikcmltgfawplaa
lkelasgeltakdneitvspr

Timeline for d6trdf_:

• d6trdf_ is new in SCOPe 2.07-stable
  
• d6trdf_ appears in the current release, SCOPe 2.08