Lineage for d6trda_ (6trd A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633191Species Thermosynechococcus elongatus [TaxId:197221] [377774] (4 PDB entries)
  8. 2633197Domain d6trda_: 6trd A: [392036]
    Other proteins in same PDB: d6trd0_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdl_, d6trdm_, d6trdy_
    automated match to d5oy0a_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trda_

PDB Entry: 6trd (more details), 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (A:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d6trda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trda_ f.29.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
pkvrvvvdndpvptsfekwakpghfdrtlargpqtttwiwnlhalahdfdthtsdledis
rkifsahfghlavvfiwlsgmyfhgakfsnyeawladptgikpsaqvvwpivgqgilngd
vgggfhgiqitsglfqlwrasgitnefqlyctaigglvmaglmlfagwfhyhkrapklew
fqnvesmlnhhlagllglgslawaghqihvslpinklldagvaakdiplphefilnpslm
aelypkvdwgffsgvipfftfnwaaysdfltfngglnpvtgglwlsdtahhhlaiavlfi
iaghmyrtnwgighslkeileahkgpftgaghkglyevlttswhaqlainlammgslsii
vaqhmyamppypylatdyptqlslfthhmwiggflvvggaahgaifmvrdydpamnqnnv
ldrvlrhrdaiishlnwvciflgfhsfglyvhndtmrafgrpqdmfsdtgiqlqpvfaqw
vqnlhtlapggtapnaaatasvafggdvvavggkvammpivlgtadfmvhhihaftihvt
vlillkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyncisvv
ifhfswkmqsdvwgtvapdgtvshitggnfaqsaitingwlrdflwaqasqvigsygsal
saygllflgahfiwafslmflfsgrgywqeliesivwahnklkvapaiqpralsiiqgra
vgvahyllggiattwafflariisvg

SCOPe Domain Coordinates for d6trda_:

Click to download the PDB-style file with coordinates for d6trda_.
(The format of our PDB-style files is described here.)

Timeline for d6trda_: