Lineage for d6trdi_ (6trd i:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631519Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) (S)
  5. 2631520Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins)
  6. 2631521Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species)
  7. 2631524Species Thermosynechococcus elongatus [TaxId:197221] [377780] (4 PDB entries)
  8. 2631529Domain d6trdi_: 6trd i: [392035]
    Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd8_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdj_, d6trdl_, d6trdm_, d6trdy_
    automated match to d1jb0i_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trdi_

PDB Entry: 6trd (more details), 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (i:) Photosystem I reaction center subunit VIII

SCOPe Domain Sequences for d6trdi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trdi_ f.23.17.1 (i:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

SCOPe Domain Coordinates for d6trdi_:

Click to download the PDB-style file with coordinates for d6trdi_.
(The format of our PDB-style files is described here.)

Timeline for d6trdi_: