SCOPe 2.07: Domain d6toza1: 6toz A:3-393

Lineage for d6toza1 (6toz A:3-393)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Bacterial alpha-amylase [51447] (10 species)

7. Species Bacillus licheniformis [TaxId:1402] [51448] (9 PDB entries)

8. Domain d6toza1: 6toz A:3-393 [392029]
   Other proteins in same PDB: d6toza2
   automated match to d1hvxa2
   complexed with ac1, acy, ca, glc, na

Details for d6toza1

PDB Entry: 6toz, 1.94 Å

PDB Description: crystal structure of bacillus paralicheniformis alpha-amylase in complex with acarbose

PDB Compounds: (A:) amylase

SCOPe Domain Sequences for d6toza1:

Sequence; same for both SEQRES and ATOM records:

>d6toza1 c.1.8.1 (A:3-393) Bacterial alpha-amylase {Bacillus licheniformis [TaxId: 1402]}
lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqddvgygaydly
dlgefhqkgtvrtkygtkgelqsainslhsrdinvygdvvinhkggadateyvtavevdp
adrnrvtsgeqrikawthfqfpgrgstysdfkwywyhfdgtdwdesrklnriykfqgkaw
dwevsnengnydylmyadidydhpdvtaeikrwgtwyanelqldgfrldavkhikfsflr
dwvnhvrektgkemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggy
dmrkllngtvvskhpvkavtfvdnhdtqpgqslestvqtwfkplayafiltreagypqif
ygdmygtkgasqreipalkhkiepilkarkq

Timeline for d6toza1:

• d6toza1 is new in SCOPe 2.07-stable
  
• d6toza1 appears in the current release, SCOPe 2.08