Lineage for d6traj_ (6tra J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631539Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 2631540Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins)
  6. 2631541Protein Subunit IX of photosystem I reaction centre, PsaJ [81542] (2 species)
  7. 2631544Species Thermosynechococcus elongatus [TaxId:197221] [377947] (4 PDB entries)
  8. 2631545Domain d6traj_: 6tra J: [392027]
    Other proteins in same PDB: d6traa_, d6trab_, d6trac_, d6trad_, d6trae_, d6traf_, d6trai_, d6tral_, d6tram_
    automated match to d1jb0j_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6traj_

PDB Entry: 6tra (more details), 2.85 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6traj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6traj_ f.23.18.1 (J:) Subunit IX of photosystem I reaction centre, PsaJ {Thermosynechococcus elongatus [TaxId: 197221]}
mkhfltylstapvlaaiwmtitagiliefnrfypdllfhpl

SCOPe Domain Coordinates for d6traj_:

Click to download the PDB-style file with coordinates for d6traj_.
(The format of our PDB-style files is described here.)

Timeline for d6traj_: