Lineage for d1cvjf1 (1cvj F:11-90)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603934Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 603935Family d.58.7.1: Canonical RBD [54929] (32 proteins)
  6. 604029Protein Poly(A)-binding protein [54948] (1 species)
  7. 604030Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)
  8. 604041Domain d1cvjf1: 1cvj F:11-90 [39201]

Details for d1cvjf1

PDB Entry: 1cvj (more details), 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

SCOP Domain Sequences for d1cvjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvjf1 d.58.7.1 (F:11-90) Poly(A)-binding protein {Human (Homo sapiens)}
aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
tmnfdvikgkpvrimwsqrd

SCOP Domain Coordinates for d1cvjf1:

Click to download the PDB-style file with coordinates for d1cvjf1.
(The format of our PDB-style files is described here.)

Timeline for d1cvjf1: