Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (20 proteins) |
Protein Poly(A)-binding protein [54948] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry) |
Domain d1cvjf1: 1cvj F:11-90 [39201] |
PDB Entry: 1cvj (more details), 2.6 Å
SCOP Domain Sequences for d1cvjf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvjf1 d.58.7.1 (F:11-90) Poly(A)-binding protein {Human (Homo sapiens)} aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald tmnfdvikgkpvrimwsqrd
Timeline for d1cvjf1: