SCOPe 2.08: Domain d6tp1a2: 6tp1 A:394-483

Lineage for d6tp1a2 (6tp1 A:394-483)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Bacillus licheniformis [TaxId:1402] [51014] (13 PDB entries)

8. Domain d6tp1a2: 6tp1 A:394-483 [392008]
   Other proteins in same PDB: d6tp1a1
   automated match to d1hvxa1
   complexed with acy, ca, glc, mli, na

Details for d6tp1a2

PDB Entry: 6tp1, 1.94 Å

PDB Description: crystal structure of bacillus paralicheniformis alpha-amylase in complex with maltotetraose

PDB Compounds: (A:) amylase

SCOPe Domain Sequences for d6tp1a2:

Sequence; same for both SEQRES and ATOM records:

>d6tp1a2 b.71.1.1 (A:394-483) Bacterial alpha-Amylase {Bacillus licheniformis [TaxId: 1402]}
yaygaqhdyfdhhnivgwtregdssvansglaalitdgpggtkrmyvgrqnagetwhdit
gnrsdsvvinaegwgefhvnggsvsiyvqr

Timeline for d6tp1a2:

• d6tp1a2 first appeared in SCOPe 2.07