Lineage for d6tnnh_ (6tnn H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348059Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2348060Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2348106Family a.149.1.0: automated matches [275200] (1 protein)
    not a true family
  6. 2348107Protein automated matches [275201] (1 species)
    not a true protein
  7. 2348108Species Bacillus subtilis [TaxId:224308] [275202] (2 PDB entries)
  8. 2348110Domain d6tnnh_: 6tnn H: [392001]
    automated match to d4ouna_
    protein/RNA complex; complexed with mg, zn

Details for d6tnnh_

PDB Entry: 6tnn (more details), 3.07 Å

PDB Description: mini-rnase iii (mini-iii) bound to 50s ribosome with precursor 23s rrna
PDB Compounds: (H:) Mini-ribonuclease 3

SCOPe Domain Sequences for d6tnnh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tnnh_ a.149.1.0 (H:) automated matches {Bacillus subtilis [TaxId: 224308]}
efdtikdskqlnglalayignaifevyvrhhllkqgftkpndlhkkssrivsaksqaeil
fflqnqsffteeeeavlkrgrnaksgttpkntdvqtyrystafeallgylflekkeerls
qlvaeaiqfgts

SCOPe Domain Coordinates for d6tnnh_:

Click to download the PDB-style file with coordinates for d6tnnh_.
(The format of our PDB-style files is described here.)

Timeline for d6tnnh_: