SCOPe 2.07: Domain d6tnnh_: 6tnn H:

Lineage for d6tnnh_ (6tnn H:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (3 families)

5. Family a.149.1.0: automated matches [275200] (1 protein)
   not a true family

6. Protein automated matches [275201] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [275202] (2 PDB entries)

8. Domain d6tnnh_: 6tnn H: [392001]
   automated match to d4ouna_
   protein/RNA complex; complexed with mg, zn

Details for d6tnnh_

PDB Entry: 6tnn, 3.07 Å

PDB Description: mini-rnase iii (mini-iii) bound to 50s ribosome with precursor 23s rrna

PDB Compounds: (H:) Mini-ribonuclease 3

SCOPe Domain Sequences for d6tnnh_:

Sequence; same for both SEQRES and ATOM records:

>d6tnnh_ a.149.1.0 (H:) automated matches {Bacillus subtilis [TaxId: 224308]}
efdtikdskqlnglalayignaifevyvrhhllkqgftkpndlhkkssrivsaksqaeil
fflqnqsffteeeeavlkrgrnaksgttpkntdvqtyrystafeallgylflekkeerls
qlvaeaiqfgts

Timeline for d6tnnh_:

• d6tnnh_ is new in SCOPe 2.07-stable
  
• d6tnnh_ appears in the current release, SCOPe 2.08